DPCfam | MC324033
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1181 |
|---|---|
| Mean domain length (aa) | 123 ± 24 aa |
| Residues in low-complexity regions (%) | 1.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08757 |
| Sequences matching dominant architecture (%) | 99.89 |
| Average overlap percent | 33.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V4RG47 | 38-152 | 115 | IPAVVEFESISGSCTLAFRGGSSLWCDKRSWHIRVDNSRLFRFGKHILLNAQFRDASLMRNSLGLYLTRKLGYPAPQTEFCTLSI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q45535-F1 | 43-138 | 90.57 | 97.29 | View in AlphaFoldDB ↗ |