DPCfam | MC323981
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 136 ± 9 aa |
| Residues in low-complexity regions (%) | 1.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05088 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 14.27 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1BDB4 | 135-267 | 133 | YRHTFPLAYEEDVTAAEAPADIADLERLRAAPQERRVSLHRASGQAPARIHLKIVKLGEPVSISDLLPMLENFGLRVIAERPYEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HZE0-F1 | 520-651 | 99.25 | 83.70 | View in AlphaFoldDB ↗ |