DPCfam | MC32397
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.21 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF12031 |
| Sequences matching dominant architecture (%) | 0.52 |
| Average overlap percent | 1.12 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R3UEG2 | 1101-1208 | 108 | QLFPPGCVEATPIDTSRRRRYRIKDLGPLTASKLVMALRCGLPSETTWALNALNIVLRDDPNALESYFSPPTQQSAVVGSSTSPT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A3E3-F1 | 1376-1467 | 95.83 | 94.82 | View in AlphaFoldDB ↗ |