DPCfam | MC323725
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 1680 ± 315 aa |
| Residues in low-complexity regions (%) | 3.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.09 |
| Average transmembrane regions | 0.76 |
| Dominant Pfam architecture(s) | PF08082- PF08083- PF10598- PF10597- PF10596- PF12134 |
| Sequences matching dominant architecture (%) | 39.58 |
| Average overlap percent | 97.46 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B7TGL6 | 2-1910 | 1909 | NKDINSRKFFNKTKQSQLSALKYLPYSILKLIENMPQPWESAKKVKVLYHITGSITFVNETPRVIPPVYLAQWSSVYDEMRLAKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4J8E6-F1 | 155-2023 | 100.00 | 88.38 | View in AlphaFoldDB ↗ |