DPCfam | MC322812
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Residues in low-complexity regions (%) | 10.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 52.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14599 |
| Sequences matching dominant architecture (%) | 1.16 |
| Average overlap percent | 3.81 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S8CXF5 | 1-58 | 58 | GGKIVTNRRKQRLNATPYDRPPSALPEKSPNWLTGIVVPRARALASNAGKILASILFD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0P0W409-F1 | 7-79 | 97.18 | 67.88 | View in AlphaFoldDB ↗ |