DPCfam | MC322746
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 140 ± 19 aa |
| Residues in low-complexity regions (%) | 2.3 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 13.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08506 |
| Sequences matching dominant architecture (%) | 48.1 |
| Average overlap percent | 56.23 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E4TVI1 | 359-494 | 136 | WQLIQPKFDGILEHVLFKSLCATNETIELFEDDPEEYFRRFFDMNKDFKTSDVASINLLFSLCFKRFPVIINSVLNLLNNVFTKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O95373-F1 | 344-483 | 100.00 | 93.13 | View in AlphaFoldDB ↗ |