DPCfam | MC322735
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Residues in low-complexity regions (%) | 5.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01493 |
| Sequences matching dominant architecture (%) | 94.34 |
| Average overlap percent | 35.59 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A142X4Q8 | 1397-1460 | 64 | LYGATEGEAYFRGRAAERFCVRNSGATAVAEGVGDHGLEYMTGGKAVILGPTGRNFAAGMSGGV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5K4EM75-F1 | 1180-1211 | 33.68 | 96.26 | View in AlphaFoldDB ↗ |