DPCfam | MC322586
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 381 ± 44 aa |
| Residues in low-complexity regions (%) | 5.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.08 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF07647- PF00536- PF00640 |
| Sequences matching dominant architecture (%) | 30.53 |
| Average overlap percent | 91.55 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183UBC5 | 969-1318 | 350 | RCSRRSNASLIAKSSFSSYFQPTTTAVADWLNVSVGIPNPRAKEIAAILESHGFDNVDHMQSTLDRLAMHEIGLDKSTQHQIGTY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q92625-F1 | 699-1068 | 99.73 | 72.55 | View in AlphaFoldDB ↗ |