DPCfam | MC322446
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 110 ± 18 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16589 |
| Sequences matching dominant architecture (%) | 43.48 |
| Average overlap percent | 82.53 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D0BYE3 | 16-165 | 150 | ILVHPDGRGYNIHLQVNGISLRPNLKGGAYASRPEDADIILVDSSQLDGKRLIRTWHQTPGKAVLEFQWLRKSMEARKPLLEVDG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q20129-F1 | 470-546 | 73.08 | 82.03 | View in AlphaFoldDB ↗ |