DPCfam | MC322022
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Residues in low-complexity regions (%) | 8.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.3 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF08544 |
| Sequences matching dominant architecture (%) | 98.27 |
| Average overlap percent | 77.85 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9X3W5 | 199-283 | 84 | SDGSILGAARSGRNDLEPPARKILPIIGEVVEWLQQQKGVSFSRMSGSGATCFALFDEIEDRDTAYKKLNIDHPEWWALSSLLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A3PGS6-F1 | 202-272 | 95.95 | 98.29 | View in AlphaFoldDB ↗ |