DPCfam | MC321661
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 299 ± 62 aa |
| Residues in low-complexity regions (%) | 3.05 |
| Residues in coiled-coil regions (%) | 0.67 |
| Predicted disordered residues (%) | 17.88 |
| Average transmembrane regions | 1.07 |
| Dominant Pfam architecture(s) | PF14604 |
| Sequences matching dominant architecture (%) | 0.83 |
| Average overlap percent | 13.22 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H6QRC4 | 104-453 | 349 | ELCYPVKGLAWYSLFAIQEFNLFMNSVYKAVGTTMDLVRFTTASLLGDLIKPADKSKHHHEMLWFDTFMFLTAITISLSFGLLVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2H160-F1 | 145-403 | 81.46 | 68.73 | View in AlphaFoldDB ↗ |