DPCfam | MC321604
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 319 ± 28 aa |
| Residues in low-complexity regions (%) | 6.74 |
| Residues in coiled-coil regions (%) | 6.63 |
| Predicted disordered residues (%) | 31.75 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A194W4M1 | 38-369 | 332 | SDDFISRLSPMNAIETFRAPSGSLKACMDAATAAEQGFAIRAAVASRNIYEWLDEIQDWPWPKEGGIGFLTPAVTKGELPSRGRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PLV4-F1 | 33-378 | 98.74 | 75.72 | View in AlphaFoldDB ↗ |