DPCfam | MC321417
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 421 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Residues in low-complexity regions (%) | 4.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.59 |
| Average transmembrane regions | 1.81 |
| Dominant Pfam architecture(s) | PF04588 |
| Sequences matching dominant architecture (%) | 97.84 |
| Average overlap percent | 74.43 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V0V797 | 69-134 | 66 | RTRERIQQITKMNPLIPVGIIGMWVALGKGLAAFMRGDRNASNKMMRYRIYFHVFTLVAITGSSVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6SSX6-F1 | 21-86 | 98.51 | 52.12 | View in AlphaFoldDB ↗ |