DPCfam | MC321120
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 294 ± 76 aa |
| Residues in low-complexity regions (%) | 9.83 |
| Residues in coiled-coil regions (%) | 1.11 |
| Predicted disordered residues (%) | 50.29 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF15961 |
| Sequences matching dominant architecture (%) | 62.32 |
| Average overlap percent | 58.32 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M9A6B4 | 704-918 | 215 | DERKKVVARTRSGRLSRPPRHMVRDYKHLHHSDFLQPDLDDSDGGYSDYNTNNDKLEEEESPKELLTGLEVPKRKISDHFSEPEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A8K0R7-F1 | 121-446 | 99.32 | 61.94 | View in AlphaFoldDB ↗ |