DPCfam | MC320741
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Residues in low-complexity regions (%) | 1.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00149 |
| Sequences matching dominant architecture (%) | 84.29 |
| Average overlap percent | 6.54 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006CEEE67 | 234-294 | 61 | GVRYVFCGHCHHNAGGMYKSLECIITTAIGGQIGGDSAGFRIVKVYDNSIKHDYYAFENVP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58DC0-F1 | 232-297 | 97.06 | 98.25 | View in AlphaFoldDB ↗ |