DPCfam | MC320465
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 175 ± 43 aa |
| Residues in low-complexity regions (%) | 14.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.39 |
| Average transmembrane regions | 0.5 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A074RT25 | 4-86 | 83 | VGVLGVMIGLGITTISEFHTLMRSLVRSSFPELHETLYSAPDTAVPGRVEVWDKERVELALEQAYALGGVRAWIDEARRQLER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D5MNM9-F1 | 63-125 | 29.90 | 62.23 | View in AlphaFoldDB ↗ |