DPCfam | MC320097
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1141 |
|---|---|
| Mean domain length (aa) | 281 ± 38 aa |
| Residues in low-complexity regions (%) | 2.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13149 |
| Sequences matching dominant architecture (%) | 94.13 |
| Average overlap percent | 83.8 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B367221 | 9-294 | 286 | LCLVAAFIATGCNQENNEPQKTPKKGTPAEFTMTINGGSNTRTITTNDSEKRTISWRTGDEVGIFAVGTDGTQNNCKYTYDGTEW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7UZ95-F1 | 11-291 | 99.25 | 89.13 | View in AlphaFoldDB ↗ |