DPCfam | MC320073
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Residues in low-complexity regions (%) | 1.63 |
| Residues in coiled-coil regions (%) | 2.77 |
| Predicted disordered residues (%) | 33.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11917 |
| Sequences matching dominant architecture (%) | 51.38 |
| Average overlap percent | 13.24 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F7U5R7 | 97-231 | 135 | IKSRIKELEALGDKISINAERLKYRKTLVRFRLSELKKYQSSWIRERRDQRILNKGKDEQALDEDDVCTRVQALIMPDFARISTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GMU4-F1 | 461-581 | 93.89 | 86.20 | View in AlphaFoldDB ↗ |