DPCfam | MC319655
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 53 ± 5 aa |
| Residues in low-complexity regions (%) | 2.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.9 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00847 |
| Sequences matching dominant architecture (%) | 91.43 |
| Average overlap percent | 9.83 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00098DA4C3 | 67-127 | 61 | LAYDQAALATRGHNAVLNFQPQLVLQSLRNMDFRFQRGFSPVLELKKRNFMNRKMRKHRER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0EXG8-F1 | 109-164 | 98.25 | 85.66 | View in AlphaFoldDB ↗ |