DPCfam | MC3196
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 1085 ± 109 aa |
| Residues in low-complexity regions (%) | 16.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 56.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00074FE7B4 | 1-941 | 941 | MDGVSEFAEYVSETVDVPSPFDLLEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A140LGY7-F1 | 98-1243 | 99.24 | 51.73 | View in AlphaFoldDB ↗ |