DPCfam | MC319369
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 264 ± 28 aa |
| Residues in low-complexity regions (%) | 2.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E2DFX5 | 71-310 | 240 | FSIEFDVLFDKTNLTTISLYNVLNSTVDMCAPKTGKKKSDTIHSRAELFVGYGNDLSLVAKGDILQHKVSARGPDRILEFKISDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GWH2-F1 | 15-317 | 98.38 | 90.73 | View in AlphaFoldDB ↗ |