DPCfam | MC319139
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 140 ± 30 aa |
| Residues in low-complexity regions (%) | 1.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F9M8V3 | 620-825 | 206 | VTPVAPGCQVFWTYIDEKGKILTLNKVLKTSTGHNAVTMAPIQPHSNTIPARTCENCHTNPKTIGYGMGNSRSKLAMNKDEPEKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-V6F2B6-F1 | 469-493 | 16.56 | 79.22 | View in AlphaFoldDB ↗ |