DPCfam | MC31908
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Residues in low-complexity regions (%) | 0.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.67 |
| Average transmembrane regions | 0.12 |
| Dominant Pfam architecture(s) | PF07180 |
| Sequences matching dominant architecture (%) | 93.55 |
| Average overlap percent | 73.56 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V1X3K1 | 32-109 | 78 | QSNHDGYIVPPCMAPWADEPLYMVVARWGQIQKRWINCNDIAEVFHIPDRRASFQLSYISRKKERVACRTRYVPAEGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0AE58-F1 | 3-68 | 83.54 | 87.66 | View in AlphaFoldDB ↗ |