DPCfam | MC319041
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 92 ± 15 aa |
| Residues in low-complexity regions (%) | 0.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.06 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF17389 |
| Sequences matching dominant architecture (%) | 62.72 |
| Average overlap percent | 29.31 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q8RX04 | 375-454 | 80 | LVSPYSSSYHLRAAFASQNGDSAMEFLNKLWWPMADTANVNYTGTFWETLDGEGKPCLGYMTSLCHSWAAGPTVELSRYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132PBA8-F1 | 502-590 | 93.18 | 96.20 | View in AlphaFoldDB ↗ |