DPCfam | MC318988
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 271 ± 25 aa |
| Residues in low-complexity regions (%) | 1.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.45 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X0CU36 | 1-336 | 335 | MFRPKEPFEGQETIDARLIETNEGTYVLSSQCVKFAKARSDDFTKYLLCEWERDGAVILKNEELLKALQNVEVTRKDDQLSLLRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VTH7-F1 | 616-896 | 99.64 | 88.88 | View in AlphaFoldDB ↗ |