DPCfam | MC318636
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 902 ± 140 aa |
| Residues in low-complexity regions (%) | 2.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.29 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF14874 |
| Sequences matching dominant architecture (%) | 19.14 |
| Average overlap percent | 8.89 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D9QPY3 | 410-1216 | 807 | ESEECDQKNDTFDSEPSDRSNISHYDEPKRCKKQTKKNIIDIFPKCKKLYSETNTPLTVALCPKFASFYKIVIFLFIRGYKKEEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DVW4-F1 | 178-1093 | 99.88 | 81.33 | View in AlphaFoldDB ↗ |