DPCfam | MC318588
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Residues in low-complexity regions (%) | 2.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.16 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04759 |
| Sequences matching dominant architecture (%) | 98.96 |
| Average overlap percent | 40.55 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J8CSM4 | 123-179 | 57 | KVTGTLFGHRKGHVTFAVQDDPKADPALLIELAISTSTLVREMSSGLVRIALECERG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1J6S7-F1 | 116-174 | 98.33 | 92.69 | View in AlphaFoldDB ↗ |