DPCfam | MC318458
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Residues in low-complexity regions (%) | 3.12 |
| Residues in coiled-coil regions (%) | 35.82 |
| Predicted disordered residues (%) | 32.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08606 |
| Sequences matching dominant architecture (%) | 66.1 |
| Average overlap percent | 47.87 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E4SIY6 | 3-134 | 132 | CAISGEPVVEAVVSPKSGSVFEKKHIINYLSTTPTDPINNEPLTVEELVAIKSTTPSFVPPVTATSIPSLLATFQNEWDALALEV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZMA2-F1 | 3-132 | 100.00 | 89.74 | View in AlphaFoldDB ↗ |