DPCfam | MC318329
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 270 ± 47 aa |
| Residues in low-complexity regions (%) | 2.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18483 |
| Sequences matching dominant architecture (%) | 39.77 |
| Average overlap percent | 20.6 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R1K640 | 219-545 | 327 | GPKHIAWGYPGDPATYFQYGSLLSKYYYLQNHQDPEESEIRGNKNQKLAWHHVLIKYTPPTDGTNNATLQYKVNDKNLNGITYTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132Z992-F1 | 262-443 | 76.24 | 92.50 | View in AlphaFoldDB ↗ |