DPCfam | MC31832
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 456 ± 74 aa |
| Residues in low-complexity regions (%) | 4.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.89 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W2QG16 | 2126-2412 | 287 | FDASSNGFNRLGVLTRLQLGIRAVCRRVNQFLLLFQLHETRTCNGLLLPPKGNQPSSPRSPKRRAESQGAMDTTSGQMKQASFFW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158Q499-F1 | 1-440 | 92.74 | 76.61 | View in AlphaFoldDB ↗ |