DPCfam | MC318250
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 289 ± 39 aa |
| Residues in low-complexity regions (%) | 5.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.53 |
| Average transmembrane regions | 3.7 |
| Dominant Pfam architecture(s) | PF00226 |
| Sequences matching dominant architecture (%) | 97.33 |
| Average overlap percent | 21.68 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D5GKX4 | 1-307 | 307 | MSALLSFIGWSFLPSLATSSFLSFWYRLITRAGDPRPQPGTPTYVKSYKLVNFLVIAFYLLYTIYESYNAILLEPNFYKLLSAGM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VR86-F1 | 4-314 | 100.00 | 85.65 | View in AlphaFoldDB ↗ |