DPCfam | MC318219
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 93 ± 17 aa |
| Residues in low-complexity regions (%) | 3.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 50.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M4AGV9 | 11-111 | 101 | PLGDGESAGSILASFGLSNDDLEVLSHYPDDQLTPDTLPFILRDIQLKKSGKQKSVSSTSSSSYSHNLTPTGSSHSVEVPSLLTV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q61464-F1 | 132-217 | 98.95 | 62.89 | View in AlphaFoldDB ↗ |