DPCfam | MC318107
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 721 |
|---|---|
| Mean domain length (aa) | 232 ± 33 aa |
| Residues in low-complexity regions (%) | 2.87 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 34.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C9SXI2 | 6-249 | 244 | GFSAWVEVENVKLQTHGEELHDGGRKATGWIASEAGKAFSIYWRDSRRTVTTKGSVTIDGIDCGHKTIHAADPRRHRHSTRDTAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CS63-F1 | 7-248 | 97.29 | 85.71 | View in AlphaFoldDB ↗ |