DPCfam | MC31809
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 76 ± 11 aa |
| Residues in low-complexity regions (%) | 1.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.55 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF17942 |
| Sequences matching dominant architecture (%) | 97.62 |
| Average overlap percent | 55.27 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6GYW8 | 102-168 | 67 | MSITRIDSLRLPFWRLWNAAGSDGRGVIGVLEADFVEPAHDKQGFERTIVLSRLETRLQQMQKTYWT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0KYY2-F1 | 442-519 | 94.05 | 92.03 | View in AlphaFoldDB ↗ |