DPCfam | MC317876
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 138 ± 7 aa |
| Residues in low-complexity regions (%) | 12.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.73 |
| Average transmembrane regions | 3.63 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U7FNN3 | 3-138 | 136 | FTGLLIALAIFSVILETLTGFSVSGSVNQIGAVLGASSDAGRHFYKKYEIIPDSGFAWRAAFQMTLVELAISVAIAGVFVWFLLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5JEX0-F1 | 33-93 | 46.10 | 97.66 | View in AlphaFoldDB ↗ |