DPCfam | MC317698
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Residues in low-complexity regions (%) | 0.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00940 |
| Sequences matching dominant architecture (%) | 97.62 |
| Average overlap percent | 23.46 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A9YES9 | 850-913 | 64 | KRNSLEDRLQYANSILNLIIDSAENPLDGEKWWMESEEPWQTLACCIEIRDAINSPDGPENFVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KPI7-F1 | 856-926 | 98.59 | 96.81 | View in AlphaFoldDB ↗ |