DPCfam | MC31743
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 102 ± 15 aa |
| Residues in low-complexity regions (%) | 2.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18998 |
| Sequences matching dominant architecture (%) | 2.13 |
| Average overlap percent | 0.62 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G0V4Z6 | 336-426 | 91 | AENRMPALSNPRVSPASGIASTQFEFLVDYYDPDGDAPDAAYKKVYISGGREGVMTLKSGTPSNGTYHYTTTLPVGSYAYNFLFA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5VV43-F1 | 760-804 | 42.16 | 91.92 | View in AlphaFoldDB ↗ |