DPCfam | MC31735
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1471 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Residues in low-complexity regions (%) | 1.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.78 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01257 |
| Sequences matching dominant architecture (%) | 99.1 |
| Average overlap percent | 95.25 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A117MTX5 | 106-253 | 148 | LSRWTADGAGSMRVVLADPVDGVADLLVPVASAFERALSRDDVRVAIKPLKIKAGASRIPDVARVALVCLGPRCAQAGGFEIYDR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P04394-F1 | 69-206 | 99.25 | 95.39 | View in AlphaFoldDB ↗ |