DPCfam | MC316797
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Residues in low-complexity regions (%) | 36.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 65.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06345 |
| Sequences matching dominant architecture (%) | 79.01 |
| Average overlap percent | 18.64 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009482DEC | 946-1039 | 94 | FYQAQKENEKIRENQEKMKRVKEAKERAEREKKEKMKLKQQKAIIDMNAEGDQEGVMDSLIEALQTGKAFSREKKEGRKRTPRGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O60879-F1 | 1005-1079 | 98.70 | 67.82 | View in AlphaFoldDB ↗ |