DPCfam | MC316735
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Residues in low-complexity regions (%) | 1.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06083 |
| Sequences matching dominant architecture (%) | 98.85 |
| Average overlap percent | 87.09 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U7RLP7 | 144-231 | 88 | TSSRLQDKSTSPWSYRVSEDPNRYPQKIVEAYCLCEGCLVNGQEDKAVNSEPFYLEVPVLQKSNQCKRGQYVYQPNHLQVAQFCF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5BJ95-F1 | 71-155 | 95.56 | 93.76 | View in AlphaFoldDB ↗ |