DPCfam | MC316570
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Residues in low-complexity regions (%) | 3.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.22 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF01569 |
| Sequences matching dominant architecture (%) | 91.53 |
| Average overlap percent | 19.92 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007E9EF18 | 1332-1421 | 90 | IARFWADGPGTYTPSGAWNQIAEEVAQQQGLSLSQAALLFAELNVAQADAGIAAWNTKYAYDTWRPDTAIQNADAIGNPNITADP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54FF5-F1 | 266-339 | 90.24 | 94.39 | View in AlphaFoldDB ↗ |