DPCfam | MC316487
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 307 ± 47 aa |
| Residues in low-complexity regions (%) | 14.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 67.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02205 |
| Sequences matching dominant architecture (%) | 8.16 |
| Average overlap percent | 7.76 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3BZJ6 | 310-546 | 236 | NSDSSPETLTCSPFSADCNCTWSESSRLQPPRQPACVWGERRGQRLICPPTQGLPPPWGEGSSHVHIWQAWSFPFSLSAQSASAQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O43312-F1 | 427-754 | 99.68 | 46.08 | View in AlphaFoldDB ↗ |