DPCfam | MC316393
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 516 ± 65 aa |
| Residues in low-complexity regions (%) | 4.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.8 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | PF00651 |
| Sequences matching dominant architecture (%) | 57.14 |
| Average overlap percent | 21.36 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165FJ71 | 622-1066 | 445 | VVICTESGSVWKRIKRAKIKDAAATGSRDFKAKDYKFSRVSGLTRVTAVRSNSFGAFSAVRTESDVTKTHVQVKDSTLSRDLAVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PW67-F1 | 561-1129 | 99.82 | 81.47 | View in AlphaFoldDB ↗ |