DPCfam | MC31637
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 402 ± 61 aa |
| Residues in low-complexity regions (%) | 12.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.86 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF00216 |
| Sequences matching dominant architecture (%) | 73.45 |
| Average overlap percent | 20.49 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U2LEV5 | 5-383 | 379 | NILDFAMDIADKHGLSADDATSFISSMFDVLTDGLQSDKQVKIKGLGIFKLSVMNARESVDVNTGERIIINSRDKISFIPDTAMR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P9WM38-F1 | 4-56 | 13.68 | 93.07 | View in AlphaFoldDB ↗ |