DPCfam | MC316366
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 168 ± 33 aa |
| Residues in low-complexity regions (%) | 3.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.43 |
| Average transmembrane regions | 0.29 |
| Dominant Pfam architecture(s) | PF13225 |
| Sequences matching dominant architecture (%) | 96.43 |
| Average overlap percent | 46.18 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A150H4C4 | 4-136 | 132 | FRRKMVSALGSDTSLSGYDAIIDLTRRLNSKFRTAAETQEATRAILNALFPSWLPGAFKWLMGPCKVNDVEIDGGAVGKGHGVLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q65XT7-F1 | 64-248 | 99.45 | 93.01 | View in AlphaFoldDB ↗ |