DPCfam | MC316297
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 431 |
|---|---|
| Mean domain length (aa) | 567 ± 95 aa |
| Residues in low-complexity regions (%) | 3.71 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 26.31 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01138- PF03725- PF03726- PF01138- PF03725- PF00013 |
| Sequences matching dominant architecture (%) | 13.75 |
| Average overlap percent | 98.41 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F4VND2 | 1-542 | 542 | VGKVDGNYILNPSSAVLEDGTKLNMMISFVGDQKKFLAVEAEAEILPEDDIFGAINFARDGADPVFKLIKEFAMEVNPEHTVYKY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4IME3-F1 | 19-626 | 99.67 | 94.96 | View in AlphaFoldDB ↗ |