DPCfam | MC316023
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Residues in low-complexity regions (%) | 11.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.95 |
| Average transmembrane regions | 0.69 |
| Dominant Pfam architecture(s) | PF12704 |
| Sequences matching dominant architecture (%) | 89.61 |
| Average overlap percent | 21.2 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00040AEF66 | 3-62 | 60 | SLMLQSLRNRRTSALLSIGVIAVAVALFVSVEMVRQQAKQSFTNTIASTDLLVGARSGDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HWW3-F1 | 4-63 | 100.00 | 91.06 | View in AlphaFoldDB ↗ |