DPCfam | MC315870
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Residues in low-complexity regions (%) | 2.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.61 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF06876 |
| Sequences matching dominant architecture (%) | 80.56 |
| Average overlap percent | 77.73 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| P82621 | 1-88 | 88 | MKCGVLFMISCLLITFLVLSHVREVESKTKWGCDMNRPFPGKCGTNGKDTCISDIKKMPGAPKDLVVRCECSQRFVWKGYPPERL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P82641-F1 | 3-89 | 98.73 | 81.74 | View in AlphaFoldDB ↗ |