DPCfam | MC315720
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Residues in low-complexity regions (%) | 2.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02253 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 30.05 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E7J3A4 | 229-294 | 66 | ISFKPWYRIDAGSVDDNPDITDYLGHYELSASYKLREHVISAMSRNNLESGFSQGAVELSWSFPLW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0P8Q8-F1 | 232-290 | 90.62 | 95.97 | View in AlphaFoldDB ↗ |