DPCfam | MC315629
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 421 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Residues in low-complexity regions (%) | 0.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M6D7W6 | 251-336 | 86 | GERKSLNDRLKKGINIGLNDRLAYIKHLFEGNAADYNRVLSQLNTINTYAEAHQFIQQQIKPDYGNWENKEVYENRFLKAIENKY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0PGV7-F1 | 476-513 | 47.19 | 91.81 | View in AlphaFoldDB ↗ |